PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g01910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WRKY
Protein Properties Length: 385aa    MW: 42032.2 Da    PI: 9.2202
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g01910genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.81.2e-2475131259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +DgynWrKYGqK+vk+ + +rsYYrCt+ +C++kk +e+s + ++v+ei+Y++eHnh+
  CA07g01910  75 RDGYNWRKYGQKQVKSPQGTRSYYRCTHFECCAKK-IECSGHTNRVMEIIYRSEHNHD 131
                 7********************************98.*********************7 PP

2WRKY96.12.5e-30247304259
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +Dgy+WrKYGqK+vkg+++pr+YYrC+sagCpv+k++er+ + + +++itY+g H+h+
  CA07g01910 247 SDGYRWRKYGQKMVKGNPHPRNYYRCSSAGCPVRKHIERAVDSTIALTITYKGVHDHD 304
                 7****************************************99999***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.4E-2072131IPR003657WRKY domain
SMARTSM007742.9E-2274132IPR003657WRKY domain
SuperFamilySSF1182903.53E-1974132IPR003657WRKY domain
PfamPF031061.3E-1776131IPR003657WRKY domain
PROSITE profilePS5081117.29376133IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.0E-31231306IPR003657WRKY domain
SuperFamilySSF1182909.94E-27240306IPR003657WRKY domain
PROSITE profilePS5081131.204241306IPR003657WRKY domain
SMARTSM007748.1E-35246305IPR003657WRKY domain
PfamPF031069.2E-24248303IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MNAQARTKHQ QRVPDESSTL ELSSTSVAQS ISSVPSPTLA ESRLSAVVNC GTGEVAKQSS  60
DAKVQPLVPV KTSNRDGYNW RKYGQKQVKS PQGTRSYYRC THFECCAKKI ECSGHTNRVM  120
EIIYRSEHNH DPSPSVTCSR ESKSAILSAS TNGKSLIDHP NRNSNETVAS SFKENLQESL  180
PIAETANLDS GGSDTDTEIN IKEEHCDEPE QKKRSRKSDA SCYESVSKPG KKPKLVVHAA  240
CDVGISSDGY RWRKYGQKMV KGNPHPRNYY RCSSAGCPVR KHIERAVDST IALTITYKGV  300
HDHDMPVPKR RHGPPSAPLI AAAAAPASIT DMKKPEPLQH QKSTTQWSVD KQGELTSEKL  360
DLGGGKAMGS ARTLLSIGFE IKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-27234306274WRKY transcription factor 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754460.0HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579780.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-107WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0V0I9Y10.0A0A0V0I9Y1_SOLCH; Putative WRKY transcription factor 32-like
STRINGSolyc07g005650.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA91892127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.13e-99WRKY DNA-binding protein 32